شماره 8 جاده Jinshun Zhuqiao Pudong منطقه جدید ، شانگهای ، چین
خانه محصولاتپپتیدهای تزریقی

پپتیدهای ساخت عضلانی CJC-1295 بدون DAC برای بدنسازان

پپتیدهای ساخت عضلانی CJC-1295 بدون DAC برای بدنسازان

    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders

    جزئیات محصول:

    محل منبع: شانگهای
    نام تجاری: FILTER
    گواهی: GMP
    شماره مدل: API


    مقدار حداقل تعداد سفارش: کرم
    قیمت: USD 4~8 per vial
    جزئیات بسته بندی: 2mg، 5mg / vial، 10mg / vial یا در صورت لزوم
    زمان تحویل: ظرف مدت 3 روز کاری
    شرایط پرداخت: L / C، T / T، ، MoneyGram، Payneer
    قابلیت ارائه: 100،000 ویال / ماه
    توضیحات محصول جزئیات
    مشخصات: 2 میلی گرم در ویال ظاهر: پودر سفید
    زمان تحویل: طی 3 ~ 7 روز کاری بندر: شانگهای / شنژن / هنگ کنگ
    بسته بندی: Icebag ، روشهای بسته بندی دقیق برای ارجاع شما LimitNum: کرم
    خلوص: 99% حمل و نقل: DHL ، Fedix ، HKEMS ، HKEUB ، TNT
    ذخیره سازی: محل خشک ، تاریک و تهویه ، (8 2 2 dogree)

    peptides bodybuilding supplements


    human growth peptides

    CJC-1295 با DAC

    نام محصول: CJC1295 DAC؛ CJC1295 با DAC
    نام مستعار: CJC1295 (GHRH / DAC)
    ترتیب: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu- Gln-Asp-Ile-Leu-Ser-Arg-LysLys (Maleimidopropionyl) -NH2 (مجتمع میل ترکیبی)
    تراکم: 1.45
    CJC-1295 با DAC
    نوع: Imunune Function AgentsGrade
    استاندارد: درجه پزشکی
    طبقه بندی: براسینواستروئید
    MF: C165H271N47O46
    وزن مولکولی: 3649.30
    خلوص (HPLC): 98.0٪
    ظاهر: پودر سفید
    تک ناخالصی (HPLC): 1.0٪
    ترکیب اسید آمینه: 10٪ نظری
    محتوای پپتید (N٪): 80٪ (توسط٪ N)
    محتوای آب (کارل فیشر): 6.0٪
    محتوای استات (HPIC): 15.0٪
    مانده حساب: 95.0 ~ 105.0٪

    شرکت تصفیه بیو فناوری با مسئولیت محدود عرصه کسب و کار، زمینه کسب و کار:

    به عنوان سازنده پپتیدها و استروئیدها ، ما برای مشتریانی که دارای مارک مورد نیاز برند هستند ، نصب شده است.
    خدمات شرکت ما:

    1. پپتید دارویی + پپتید Bodubuilding
    2. پپتید آرایشی
    3. پودر استرودیس ، روغن و زبانه ها
    4. خدمات سفارشی

    کدام یک از مشتریان شما را ترجیح می دهند؟

    نام محصول: CJC1295
    مترادف: CJC1295؛ Y (d-A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2؛ L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-thononyl-L-glutaminyl-L-glutaminyl-L-glutaminyl-L- L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L- لوسیل-L-گلوتامینیل-L-α-آسپارتیل-L-ایزولوسیل-L-لوسیل-L-سرییل-L-آرژینیل-N6- [3- (2،5-دی هیدرو-2،5-دی اکسو-1H-پیرول-) 1-الی) -1-اکسوپروپیل] -L-لیزینامید ؛ CJC-1295 استات ؛ CJC1295 با DAC خارج
    CAS: 863288-34-0
    MF: C159H258N46O45
    MW: 0
    دسته بندی محصولات: پپتیدها

    روند ما:
    فرایند کنترل کیفیت
    1) خرید
    تحقیق دقیق در مورد بازار ، قیمت مواد اولیه و عملکرد را درک کنید. برای تهیه منبع کالا برای درک کامل ، و به طور کامل تضمین کیفیت تهیه مواد اولیه.

    2) بازرسی
    چهار مرحله: نمونه گیری ، پیش پردازش نمونه ، اندازه گیری و پردازش داده ها.

    3) تولید
    الف) هر اپراتور باید محصولات خود را بازرسی کند و سوابق مربوط به بازرسی را تهیه کند.
    ب) بازرسان تمام وقت از طریق بررسی خودآزمایی اپراتور ، و ثبت و ثبت پرونده مربوطه. بازرسی تمام وقت مسئول بازرسی از محصول نهایی است و سوابق بازرسی ورودی محصول نهایی را انجام می دهد.

    4) قبل از فروش
    نتیجه آزمایش را می توان قبل از فروش ارائه داد.
    در صورت عدم رضایت از نتایج آزمایش ، موسسه تشخیص شخص ثالث مجاز است.

    مزایای ما:
    1. کیفیت:
    شرکت ما سالهاست که تولید حرفه ای واسطه های هورمونی است ، محصولات ما به کشورهای آلمان ، اسپانیا ، انگلیس ، ایالات متحده ، استرالیا ، خاورمیانه و غیره به کشور های دیگر صادر شده است و ما بازخورد بسیار خوبی از مشتریان خود گرفته ایم ، می توانید به ما اعتماد کن
    و ما کارخانه هستیم ، بنابراین برای کنترل کیفیت مشکلی برای ما نیست.
    2. روش پرداخت: ، TT.
    3. خدمات: بهترین خدمات با خدمات پس از فروش به کلیه مشتریان.
    4. تحویل:
    سفارش نمونه: بسته بندی بعد از پرداخت با 3 روز ارسال می شود. ما می توانیم آن را از طریق UP ، EMS ، HK Air Post ، DHL یا سایر متودها ارسال کنیم. ما یک لجستیک حرفه ای و پایدار داریم و می توانیم بسته بندی را در حدود 3 تا 5 روز به راحتی تحویل دهیم.

    سایر آزمایشگاه های پپتید ما:

    تولید - محصول خلوص شماره CAS
    گلوکاگون هیدروکلراید 98٪ 16941-32-5
    گنادورلین استات 98٪ 34973-08-5
    Goserelin استات 98٪ 145781-92-6
    GRF (انسانی) استات 98٪ 83930-13-6
    هگزارلین استات 98٪ 140703-51-1
    هیسترلین استات 98٪ 76712-82-8
    Icatibant استات 98٪ 30308-48-4
    لانروئیدید 98٪ 108736-35-2
    لسییرلین (Dalmarelin) استات 98٪ 61012-19-9
    لوپرولید 98٪ 74381-53-6
    لوپرولین استات 98٪ 53714-56-0
    Linaclotide Acatate 98٪ 851199-59-2
    لیکسیزاناتید 98٪ 320367-13-3
    لراگلوتید 98٪ 204656-20-2
    لیزیپرسین استات 98٪ 50-57-7
    ملانوتان دوم استات 98٪ 121062-08-6
    MOG (35-55) 98٪ 163913-87-9
    نفرلین استات 98٪ 76932-56-4
    Nesiritide استات (BNP-32) 98٪ 114471-18-0
    اکتروتید 98٪ 79517-01-4
    اورنیپرسین استات 98٪ 3397-23-7
    اکسی توسین استات 98٪ 50-56-6
    پالمیتیل پنتاپپتید 98٪ 214047-00-4
    پیکسیگانان 98٪ 147664-63-9
    پراملینتید استات 98٪ 30-78-30-5
    PT141 استات 98٪ 32780-32-8
    سالمون کلسیتونین استات 98٪ 47931-85-1
    Secretin Acetate 98٪ 10813-74-8
    سرمورلین استات 98٪ 86168-78-7
    Sincalide 98٪ 25126-32-3
    سوماتوستاتین استات 98٪ 38916-34-6
    اسپلنوپنتین استات 98٪ 105184-37-0
    تالتیرلین استات 98٪ 103300-74-9
    Teriparatide استات 98٪ 52232-67-4
    Teriparatide استات 98٪ 52232-67-4
    ترلیپرسین استات 98٪ 14636-12-5
    تتراكوساكتید استات 98٪ 16960-16-0
    تیمالفاسین 98٪ 62304-98-7
    تیموپنتین 98٪ 69558-55-0
    تیموسین α1 استات 98٪ 14636-12-5
    تیموسین β4 استات (TB-500) 98٪ 77591-33-4
    تریپتورلین استات 98٪ 57773-63-4
    Vapreotide استات 98٪ 103222-11-3
    وازوپرسین استات 98٪ 9034-50-8
    زونوتید استات 98٪ 107452-89-1


    خط مشی مشتریان VIP:
    اگر در کل سال مبلغ خرید شما در شرکت ما می تواند به 50،000 دلار برسد ، در پایان سال می توانیم از 2٪ -5٪ از کل مبلغ برای ارسال کالای رایگان استفاده کنیم.

    انواع مشتری که پشتیبانی بیشتری داشتند:
    مشتری 1.Potential
    (با خرید داده + تعداد مشتری در حال انجام مشتری در بازار و تعداد محصولات در ماه برای درخواست)

    گروه مشتری 2.Stable و سفارش تعداد پایدار در هر ماه
    (با داده های خرید کامل با شرکت ما برای اعمال درخواست)

    کاربران شخصی 3.Regular
    (با داده های خرید کامل با شرکت ما برای اعمال درخواست)

    4- مشتریانی که دارای بودجه هستند و برنامه ای برای گسترش بازار دارند
    (با خرید داده + تعداد مشتری در حال انجام مشتری در بازار و تعداد محصولات در ماه برای درخواست)
    ** داده های واقعی فعلی + بازار آینده (بر اساس جریان فعلی)

    اطلاعات تماس
    Passion Technology Development Limited

    تماس با شخص: Qin

    ارسال درخواست خود را به طور مستقیم به ما (0 / 3000)

    سایر محصولات
    درخواست نقل قول

    E-Mail | نقشه سایت

    Privacy Policy چین خوب کیفیت پپتیدهای تزریقی تامین کننده. © 2018 - 2021 peptide-steroids.com. All Rights Reserved.